SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1X165 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1X165
Domain Number 1 Region: 111-231
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-34
Family cAMP-binding domain 0.00000143
Further Details:      
 
Domain Number 2 Region: 240-363
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-31
Family cAMP-binding domain 0.00000228
Further Details:      
 
Domain Number 3 Region: 10-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.7e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1X165
Sequence length 374
Comment (tr|A0A0A1X165|A0A0A1X165_ZEUCU) cAMP-dependent protein kinase type I regulatory subunit {ECO:0000313|EMBL:JAD05094.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.52242 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MANTLEEQQSLRECENYIQAHGIQRVLKDCIVQLCVSRPENPIQFLRQYFQKLEKEQVKL
DAHKQVTSPDDFEDLSPMPQTAAPPVRRRGGISAEPVTEEDATSYVKKVVPKDYKTMAAL
SKAIAKNVLFSHLDENERSDIFDAMFPVTHLMGENIIQQGDEGDNFYVIDHGEVEVFVNS
ELVTTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE
FLSRVSILESLDKWERLTVADALEPVSFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAE
QGDEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILK
RNITQYNSFVSLSV
Download sequence
Identical sequences A0A0A1X165
XP_011181367.1.96551 XP_011181368.1.96551 XP_011181369.1.96551 XP_014092186.1.97495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]