SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1X1I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1X1I2
Domain Number 1 Region: 107-241
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.07e-39
Family Fibrinogen C-terminal domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1X1I2
Sequence length 241
Comment (tr|A0A0A1X1I2|A0A0A1X1I2_ZEUCU) Tenascin-N {ECO:0000313|EMBL:JAD04508.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.49761 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MAHRFIFLSILCGHLLYSVNCSTPIQSSANVAPFLTYLCDDDLLKSAVNKVEHLSLKLEN
YNLRMQSELIAMKEQLLHEVKTNLELFDLKTTTKCNEANKNLETVSPATKKPSSCTEAMR
TENGKYAASGVYELYLPAYLHNAFHVYCLRDPNGGEPWTIIQRRQSNDTDFYRGWIEYEQ
GFGDLNANFFLGLEKIHALTHSQPHELWFELEDFQNEKRVANYDSFAIGNAQEKYELSIL
G
Download sequence
Identical sequences A0A0A1X1I2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]