SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1X3D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1X3D1
Domain Number 1 Region: 163-287
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-37
Family Regulator of G-protein signaling, RGS 0.00013
Further Details:      
 
Domain Number 2 Region: 466-550
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-23
Family Ras-binding domain, RBD 0.0046
Further Details:      
 
Domain Number 3 Region: 410-477
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000517
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1X3D1
Sequence length 1011
Comment (tr|A0A0A1X3D1|A0A0A1X3D1_ZEUCU) Regulator of G-protein signaling loco {ECO:0000313|EMBL:JAD05804.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.43068 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MNSMLELVCGLYSEENEPNPNLPANASPFRRAWGQSSFRTPRTDKRALQQLQLQQQSGQH
QHLSPLVRRSSSMTASDNDVYIKSIHHTDYHDELKQAHSQHQIATSAAAIVAARNANAVA
AVSAATLATANAKNIKIGSCTNQLKMPQLKTTSSTATDNGVGGVTAWGTAFERLLEDPAG
MHTFAEFLKKEFSAENIYFWTACERYRALESSVERSTQAMAIFSKHLANGALEPVNVDSQ
ARNLTQEKLESAEPDIFAPAQKQIFNLMKFDSYQRFIRSDMYKSCLEAEEKRQPLPYKAE
DLDELLRTPAHQPVSVSSIVSKLKKSASNAEDRCRKSLLPWHRKTSSNKAPRDGADAPSE
CKTTTNKLAPLSSHSLKVAPAQNSQSDIHSSRSSLSSFDGLPGASILPGTCRVILSDAST
TMVQARANETVGQLVERLLEKRGLSYQYYDVVAKGTTKSIDLQTSSQTLVGKEVMIEQRV
AFKMDLPDRKVISVKSKPKKQLHEVVCPILHKYNYDIEEVQVVMRETQEPIDLSLTVTHA
DGQRLQALWLKPPPLLQCNDYQNGNGCAPKVAKASTSTKSVSFPSALKQANGGALRSTAG
NSINVSHSTQSALDEITNKVFTELMQVKVEAASAEKTQPLAAHNGKVNDHASLKSDDCAS
ETSSIFERIRRRDNNIQSLKLKLKKRSTSSQHSEETNQSCHTTASNGQLPAPTAVSTTVL
DIKKPIIAKLKAGVKLQMPERVAENQDELLEGLKRAQLARLEDQRGTEINFELPDFLKNK
ENLNASKLRKARANLSPINKPPTQISVAATDEQPAQTAPQPTLQERPQPAPRLSITNKLK
ANTTVSPLKHEPDAPAQSNTLEVRQTEPATPLTANPTSAILESEYAAALVGTNSCKGPPP
LPPKPKVLPIKPSNWGAAASMSNSSAASTPTTPSTTSIPTLPTPTHKSFTTVGLTNSVTT
NVEDAPLMLHVSSKHFTPNEIAPRKTHLSIATEQPTSARCAYLEEPSSSFV
Download sequence
Identical sequences A0A0A1X3D1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]