SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1X3Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1X3Q4
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.4e-43
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1X3Q4
Sequence length 284
Comment (tr|A0A0A1X3Q4|A0A0A1X3Q4_ZEUCU) Poly(A) RNA polymerase gld-2 homolog A {ECO:0000313|EMBL:JAD05365.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.18777 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MVLVTKLWAQYHNINNAKNMTISSYSLVLMVIHFLQYAVSPAVLPCLHDLFPDKFPLLRS
NDFGYVDMNETIGPYESKNTQTIGELFLYFLEYYSCFDYTQFAISVRTGGILPINVCRLA
KSSKNDIHQWKELCIEEPFDLTNTARSVYDFETFERVKAVFVASWRILQQTLDLNSIFAP
IIIPSSNSISSTLRHAGFQYDDCNNSTPSEVSTSDPNNININANGSTILLGSDNSANVSP
ATSLSSLPIEPNNNNNNNHITKEIFNNANGKNNSVGGSLTELVS
Download sequence
Identical sequences A0A0A1X3Q4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]