SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1X996 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1X996
Domain Number 1 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1X996
Sequence length 176
Comment (tr|A0A0A1X996|A0A0A1X996_ZEUCU) c-Myc-binding protein homolog {ECO:0000313|EMBL:JAD07712.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.28505 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MAFKPIDPKRDEFRRYLERSGVIEALTKVFVRIVKERPENPLDYLRNNLGDALHQADSVS
YLQSELEEARSEIQRLRGIIESINPDALREPEDVEKKNDEATENQEKCVEENAKDQESES
EPVVVTNELEIASKAESPVQSNSSRNDDTVKNSETPDDSDTANNASNLTAAQTDNN
Download sequence
Identical sequences A0A0A1X996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]