SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1X9T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1X9T8
Domain Number 1 Region: 104-224
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-33
Family cAMP-binding domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 228-348
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-30
Family cAMP-binding domain 0.00025
Further Details:      
 
Domain Number 3 Region: 6-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1X9T8
Sequence length 379
Comment (tr|A0A0A1X9T8|A0A0A1X9T8_ZEUCU) cAMP-dependent protein kinase type II regulatory subunit {ECO:0000313|EMBL:JAD07852.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.44254 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MSAESKQRIQVPEALREVLLEFSIAYLLEQPGDVVEYAVQYFNKLQSNRQAAANFYRPDS
PESSIISQEEEPVRRFTTRRKSVFAEAYDPENDADDDEAERKVYPKSDEQRARLTDSVKN
VLLFRSLDDEQMNQVLDAMFEKRVQPDEFIIRQGDDGDNFYVIESGVYKVICNGDHIFTY
DNTGIFGELALLYNVPRAASIQAVTEGLLWAMDRQTFRRILLKSAFKKRKMYETLLDSVP
MLKALKSYERMNLADALVSKHFCSTERIIKQGDVADGMYFIEDGNVVVKMDQDGKEIEIS
RLGKGQYFGELALVTHRPRAASVYADGDVKVAFLDTDCFERLLGKCANLLESGISGYRYL
DDDLRIYYDNITMFQNMQL
Download sequence
Identical sequences A0A0A1X9T8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]