SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1XF39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1XF39
Domain Number 1 Region: 654-733
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-26
Family DIX domain 0.00093
Further Details:      
 
Domain Number 2 Region: 41-174
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.77e-23
Family Regulator of G-protein signaling, RGS 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A1XF39
Sequence length 735
Comment (tr|A0A0A1XF39|A0A0A1XF39_ZEUCU) Axin {ECO:0000313|EMBL:JAD09103.1} OX=28588 OS=Zeugodacus cucurbitae (Melon fruit fly) (Bactrocera cucurbitae). GN=g.19781 OC=Tephritoidea; Tephritidae; Zeugodacus; Zeugodacus.
Sequence
MSHPSGFRKYDDNECSGPRPPVPGEESRVKKMTEGVADSSRNSPPSYLNWARTLNHLLED
RDGVELFKKYVEDEAPGYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYRFLRKSQLSIPE
DLRRIIKAGLKNEVPLNANIYDSMQQYVEATIRDNIYPSFLCSEMYILYIQQMSVSHERF
GIGAAGSGSGSSSGASCGSSGAGIAASTGGACALPTNSGKVACSSVTPFINLPMSTAGGN
IPIGGACSASGSVYGPSTSASSSGSISATDTLPRSSTLPTLHEDSELSLCDDFEKLRVEG
GRVAADMPIRLTHDLLLATQKRRLEIRPPGAHGYVYPATANTSYVPNSRVDSERASVSSG
GRTDSDTMSLSSCSMDGRPYIQRRHSSNESKAIRQSAMANKETNTFQVIPRTQRLHSNEH
RPLKEAELIALLIPKLEEVKRKQDIEDRARCDRFTDDSMPTNERLASDRAFADAIREKFA
LEEDNDQDILDQHVSRVWKDQTPPRSPGTMSPCPPLPTRRRTITHDSGMLSDGAMSIGGH
SMKHSKSMPDHSSSSRKLTNKWPSINTDSGISLYSADTLMKYKDTSSRSGSSTASKSEEA
KRRLEDETRRSRRYTQQQHIQPSQQPPSFSSSSSGSSSLHHQPQPPPLPAKPLETTTVVF
SFCDEEYPYRTKIPGSQPTLKQFKDYLPKKGNFRFFFKTHCEDPESPVIQEEIVNDSDIL
PLFEGKVMGLVKPSD
Download sequence
Identical sequences A0A0A1XF39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]