SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1YUJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1YUJ3
Domain Number 1 Region: 59-72,135-225
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000000294
Family TolA 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A1YUJ3
Sequence length 234
Comment (tr|A0A0A1YUJ3|A0A0A1YUJ3_PSEFL) Energy transducer TonB {ECO:0000313|EMBL:KGE64566.1} KW=Complete proteome OX=1324332 OS=Pseudomonas fluorescens LMG 5329. GN=K814_0128740 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTAQIPIAPLPVKKKPPLRPLKWGAGLLLGAVAAWCLWQWANDMSGVRREAPKVPTIIPL
PPPPPPPPEKPKEPEPQVEEKIPEPVPSPEPEEVKPAEEAPPSPSEDLANPMQIDGDAQS
GNDGFNIGAGKGGGMAGSGGGGLGTGTYKQYLAGTYQRLMREDPELRKKAFSIQIDLWLG
AEGQVTKALVAKSSGDAETDAQMLALIQAPRATQKPPASLTLPMRLSLKGRRPD
Download sequence
Identical sequences A0A0A1YUJ3
WP_038850808.1.24299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]