SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A1YZI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A1YZI1
Domain Number 1 Region: 91-220
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.62e-40
Family PH0987 C-terminal domain-like 0.0000189
Further Details:      
 
Domain Number 2 Region: 4-95
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.00000000000000392
Family PH0987 N-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A1YZI1
Sequence length 234
Comment (tr|A0A0A1YZI1|A0A0A1YZI1_PSEFL) Allophanate hydrolase {ECO:0000313|EMBL:KGE67338.1} KW=Complete proteome OX=1324332 OS=Pseudomonas fluorescens LMG 5329. GN=K814_0113705 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKPRIEVVAIDCLMVRLFDAIAEANMPWMLAATHRLRNGFGAALVDLVPSYTTLMVHYDL
SALNPAQARELIDQALTDLQPRTQGSGQCHVLPVWYDQSVGPELSLLSQRSGLSVDDVIR
RHSAHEYQVFALGFAPGFAFMGLVDEILAAPRLSTPRKRVAAGSVGIAERQTAAYPVVSP
GGWNLIGRTPARLFDRERDGYSLMQPGDTVRFEPVDHAQFIKLGGDDTPLEAQA
Download sequence
Identical sequences A0A0A1YZI1
WP_038846223.1.24299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]