SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2A8Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2A8Y4
Domain Number 1 Region: 87-216
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 5.23e-27
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2A8Y4
Sequence length 218
Comment (tr|A0A0A2A8Y4|A0A0A2A8Y4_PROMR) Circadian phase modifier {ECO:0000313|EMBL:KGF96959.1} KW=Complete proteome OX=74545 OS=Prochlorococcus marinus str. MIT 9302. GN=EU96_1599 OC=Prochlorococcus.
Sequence
MNFDIRFDFQRRERLGLIEAIWGQDKSIDQLKRLSENVLGKNEVVFITRINSEKANYLLD
LYDYGRFYEEAKCLIIGDNLNKLNTNKKVAIISGGSSDLAVTLEAQLALEIYGVNCQSFI
DVGVAGLHRLISQLEEINKYDVLIVCAGMEGALATVVGGLLAQPIIAVPVSVGYGVSKNG
ETALNSMLSSCSPGIAVMNIDNGYGAAMAALRIIKSIS
Download sequence
Identical sequences A0A0A2A8Y4
WP_032527209.1.93959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]