SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2B6B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2B6B6
Domain Number 1 Region: 5-235
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.25e-67
Family Eukaryotic type heme oxygenase 0.000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2B6B6
Sequence length 236
Comment (tr|A0A0A2B6B6|A0A0A2B6B6_PROMR) Heme oxygenase {ECO:0000313|EMBL:KGG08692.1} KW=Complete proteome OX=59926 OS=Prochlorococcus marinus str. SB. GN=EV02_1365 OC=Prochlorococcus.
Sequence
MAVALAGQLREGTKKSHTMAENTGFVACFLKGVVEKKSYRKLISDLYFVYEAMEEEIERL
VNEEHPVIKPIGFKSLYRKETLVNDLKFYFGENWKNEINISHSAKEYVERIREVAKNSPE
LLVGHHYTRYIGDLSGGQILKRIAKKALNLQGNDGLNFYEFELIADEKKFKEEYSITLNK
LPINQKTADQIIDEANQAFTYNMKMFKELEGNLIAVLGKIVFNYITKKVRKGSTET
Download sequence
Identical sequences A0A0A2B6B6
WP_032520015.1.81093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]