SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2B6G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2B6G5
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.12e-51
Family TENA/THI-4 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2B6G5
Sequence length 207
Comment (tr|A0A0A2B6G5|A0A0A2B6G5_PROMR) Thiaminase II {ECO:0000313|EMBL:KGG08184.1} KW=Complete proteome OX=59926 OS=Prochlorococcus marinus str. SB. GN=EV02_0852 OC=Prochlorococcus.
Sequence
MKITKKLWEDNYEIALLSLNTKFVQGLKNGSLPKNIFQEYLAQDYFFLETFAKAYGLAVS
KSKDKYSIRKLSELLMGVSEELILHETYAKEWDIDLSNNYIKKATKNYTDFLDDTSKRLS
SIEIMFAMTPCMRLYSWIGKRLYKEDFDIKYKEWIITYSDESFEKLADSLENLIETNKGT
YDINQAKYLYRRAMELELDFFNAYSDF
Download sequence
Identical sequences A0A0A2B6G5
WP_032519563.1.81093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]