SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2CVM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2CVM7
Domain Number 1 Region: 63-183
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.57e-29
Family N-utilization substance G protein NusG, N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 171-244
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.57e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2CVM7
Sequence length 246
Comment (tr|A0A0A2CVM7|A0A0A2CVM7_9PROC) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1499502 OS=Prochlorococcus sp. MIT 0701. GN=EV12_0324 OC=Prochlorococcus.
Sequence
MCRAVLLSCINRLSKTISFLSAQVSELELTPQEPSEVLELPAPNDGEEGTKAPTPAARTT
VARWYAVQVASSCEKKVKATLEQRAVTLGVSNRILEIEIPQTPAVKLKKDGSRQSTEEKV
FPGYVLVRMVLDEDTMMAVRSTPNVINFVGAEDRRATGKARGHIKPRPLSRQEVDRIFKR
AAEKKTLVKVDLAEGDQILVTSGPFKDFQGEVIEVSGERSKLKALLSIFGRETPVELEFS
QINKQN
Download sequence
Identical sequences A0A0A2CVM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]