SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2DL07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2DL07
Domain Number 1 Region: 31-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000889
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2DL07
Sequence length 145
Comment (tr|A0A0A2DL07|A0A0A2DL07_9CORY) Uncharacterized protein {ECO:0000313|EMBL:KGM18427.1} KW=Complete proteome OX=99807 OS=Corynebacterium auriscanis. GN=MA47_07445 OC=Corynebacterium.
Sequence
MINLEDFAGFEDSYAFGKGSRLREIEAGFAEAPAWLPEDFKYLFTQCDRWALVGVEMFSP
LPVPYSPDRRALTLNAEFHEDYPGHDDLFAAGEMGDNDYLVLQYVEDAVMCGYFNTEDEE
WFGKKFPSLTAWAYACLKANGDPSV
Download sequence
Identical sequences A0A0A2DL07
WP_035114896.1.12490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]