SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2DU25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2DU25
Domain Number 1 Region: 6-147
Classification Level Classification E-value
Superfamily Ferritin-like 1.06e-41
Family Ferritin 0.0000155
Further Details:      
 
Domain Number 2 Region: 149-191
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000199
Family Rubredoxin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2DU25
Sequence length 192
Comment (tr|A0A0A2DU25|A0A0A2DU25_9PORP) Rubrerythrin {ECO:0000313|EMBL:KGN83529.1} KW=Complete proteome OX=111105 OS=Porphyromonas gulae. GN=HR08_10765 OC=Porphyromonadaceae; Porphyromonas.
Sequence
MNKSIKGTKTEKHLLMAFAGESQARSRYTFFASVAKKEGYEQIAGVFMETAEQEKEHAKR
FFSFLEGGMLEITASFPAGVIGSTAENLRAAAAGENEEWTDLYPAFAETAEEEGFKEIAA
VFRQVAKVEAEHERRYLALLAHVENGSFFERTEEIAWQCRNCGYVVTSKKAPKLCPACAH
PQAYFEPMKTNY
Download sequence
Identical sequences A0A0A2DU25
WP_039422388.1.51434 WP_039422388.1.5346 WP_039422388.1.88075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]