SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2K0P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2K0P5
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.34e-30
Family Cofilin-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2K0P5
Sequence length 141
Comment (tr|A0A0A2K0P5|A0A0A2K0P5_PENEN) Glia maturation factor beta {ECO:0000313|EMBL:KGO60641.1} KW=Complete proteome; Reference proteome OX=27334 OS=Penicillium expansum (Blue mold rot fungus). GN=PEX2_088230 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MSDSRLYSFSPETKEKLRKFRLGTSRAKDAQAIIYIIDAKTQEIRPQDDEIYSKMEDLAD
DLPESSPRFILLSYPMTTKDGRPSVPYVLLYWLPENCNPMQRMSYANAVELMRTSAQVNR
VIEVEADEDIIDIKSKLTGSD
Download sequence
Identical sequences A0A0A2K0P5
XP_016601698.1.99153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]