SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2KA89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2KA89
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.62e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.002
Further Details:      
 
Domain Number 2 Region: 79-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.52e-16
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2KA89
Sequence length 193
Comment (tr|A0A0A2KA89|A0A0A2KA89_PENIT) RNA polymerase III, subunit Rpc25 {ECO:0000313|EMBL:KGO63833.1} KW=Complete proteome; Reference proteome OX=40296 OS=Penicillium italicum (Blue mold). GN=PITC_054590 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MFILTTISDLIQISPEDFSKFSAVALEDNINAKYANKVIQKIGLCISFYDLLESSDGLIG
HGTGLVNVNVKFRMIVFRPFKGEIMLGKISSGTEHGIKIGLEFFNDILIPPQMLMEKSRF
DYAEQVWIWESEGGTEFFFDVGEVVRFRVESEEWHDQIPNAPDVADETPQERRPPYSILG
SMQMGGTGPITWW
Download sequence
Identical sequences A0A0A2IW11 A0A0A2KA89 A0A135LF25
XP_016599619.1.99153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]