SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2KBB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2KBB6
Domain Number 1 Region: 845-974
Classification Level Classification E-value
Superfamily PX domain 6.8e-26
Family PX domain 0.00061
Further Details:      
 
Domain Number 2 Region: 411-552
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.83e-20
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2KBB6
Sequence length 1511
Comment (tr|A0A0A2KBB6|A0A0A2KBB6_PENIT) PX-associated, sorting nexin 13 {ECO:0000313|EMBL:KGO65119.1} KW=Complete proteome; Reference proteome OX=40296 OS=Penicillium italicum (Blue mold). GN=PITC_013780 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MALSSRDLVLAGVGVFIAWGLVVRWLPILRYLGYAVTLGAVLSSVGILGLFALTIRHQKE
KVNKTVSVAFIKPNQWRKEVLNVRRSTRYRPRPLYPQSFVVSEGIDELLSFITRDFISSW
YGSISPNPIFANEVDRTIRVALENLRDRLVAEDMVSLIVSRIFPIVTSHLKEFDIAERSV
RGRNLNRNVTESGELDLAIANKYREGRLHPAVATSASDQKSVQQEYLRKLAVGLLPQLFP
ESVLNSRIVSVLIREIISCAVLIPMVTSLSDPDTWNQLMEAYGRTALQDRKTVRKLRAAL
DQHASPRPKSKRGQPFPRLSATDSERAFERFVRAIRKCNNLSDARRFRALVSSQLKQESV
VEGQDPVYLKRLETGKRVLDQKVANLARPGDNSHVPPALDLRPEIPSRTHESSLVDVMHS
ASGLSYFMEFMDRQKLMSLVQFWVVVDGFRNPLEDDFGDEAVPTSLAWKPADRNDLALIS
ETYLSKPELKVSEESRRVVKTFLSAGKRATPEQYRKARMVVLTTQSAILEDLQDTYYPKF
KESDLYWKYLASDEASAAQAPVRQSSPIAVSFETPERRSLPPLLSRTTSQPGLRTSKDLR
RAAVSSSDVRGMGKLFDDDDSPRRSIDSERSGHLFDEDYDTDNLATSTHSLGKDSQSGEN
DAGQSQSQVLETMEAALNDIITNEPKNARIEDLKGDAAGLFGPERPVLSSRSSSEIPQVD
NRNERTKKSIASLGLVDHASRLGVFHDDLFPDQQKFIEDEYEEPDGVDEKDSADEVHEAA
PGDLGLTEAIEALSVDIDKLAAQDAVVQALTRKAELTNNTAELRILRKSKASIQREMHRK
EMQRQQYILQESDNSLFGRSTVSLKSTVVGKEEDDGREFAMYVVEVRRNAGEQMPAASWV
VARRYSEFHDLHQKLRQRYPSVRHLEFPRRRVVMKLQKEFLQKRRLALEAYLQKLLLLPE
VCRSRDLRAFLSQRAILPRKENSRDNEGETKDIVTRIYNSVTDGMDDFLGNFGVLDQLST
AGQNLISAATQQASNTTVPDSSLATEDAVTAAEAEAELNAFEDRELEPFIKPICDLFLEA
FELNRGNNWLRGRAVVVVLHQLLGGTIERKVRDGARGLVQDDSLTKYLALARDTLWPGGV
LRKAPPRSAADRLNSRAEATVVLATLIPDLAGNVVGRANAQAAARRIFATLNNQHLNTHL
VFTILDEIVLLIFFFPLTPMAPPPTPAQSYALSIPEIFELILLSLDTRTLLTKATRICHT
WSHFINSSPPIQWALFFRPLDNALNKAKIQNPLLAETFPSIFHQSGSSNRANPNKKNDTD
TDTTNEKTTSKLTFTTFDMVKNPHKWDAYIRPEASWRRMLVQQPPVYTLSLLRSNVGHGG
QSLYIYEALDDPKISAGGLRMDIVFESLIFGDRWDQNEYSATEMVWGQEFLPQRICEDLE
LFGVRDLDLVFYTRLGEAYRGRNYYYSSLESSLECDVVKNVKAAYTRLGMKPKYSDEVFL
RGRKSWGSLWD
Download sequence
Identical sequences A0A0A2KBB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]