SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2LYQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2LYQ6
Domain Number 1 Region: 6-183
Classification Level Classification E-value
Superfamily VC0467-like 5.49e-53
Family VC0467-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2LYQ6
Sequence length 186
Comment (tr|A0A0A2LYQ6|A0A0A2LYQ6_9FLAO) Transcriptional regulator {ECO:0000313|EMBL:KGO85517.1} KW=Complete proteome; Reference proteome OX=1121895 OS=Flavobacterium rivuli WB 3.3-2 = DSM 21788. GN=Q765_15965 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MISLKPKKGHLLVAEPSTIGDQSFNRSVVLLADHNDEGSVGFILNKPLGYSINDLVPEIR
ASFKIYNGGPVEQDNLYFIHNIPELIPGSIEISNGIYWGGDFDSTKELINNGLIKKNNIR
FFLGYSGWNAHQLEDELEENSWIISENRYNNKIIGKSSTSFWKEKIMELGGDYLIWSNAP
ENPALN
Download sequence
Identical sequences A0A0A2LYQ6
WP_020214632.1.10520 WP_020214632.1.57041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]