SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2M854 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2M854
Domain Number 1 Region: 24-167
Classification Level Classification E-value
Superfamily OmpH-like 6.41e-25
Family OmpH-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2M854
Sequence length 169
Comment (tr|A0A0A2M854|A0A0A2M854_9FLAO) Membrane protein {ECO:0000313|EMBL:KGO88847.1} KW=Complete proteome; Reference proteome OX=1121899 OS=Flavobacterium suncheonense GH29-5 = DSM 17707. GN=Q764_11495 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MKQLKTLLIAAALFLGANQTISAQAKVAHIDVQELMTTMPEMKTAQAQVKKIGETYEKEY
QTLVTEYQNKMKKYESEATTVGEAVNETRAKEMQDMGQRIQQFRETAQKELQQKEMDLVK
PIMDKAKNAIQKVAKAKGYQYVLDSTSGSGVILADGPNLLADVKKELGF
Download sequence
Identical sequences A0A0A2M854
WP_026979637.1.44224 WP_026979637.1.93140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]