SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2NE25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2NE25
Domain Number 1 Region: 15-133
Classification Level Classification E-value
Superfamily PapD-like 7.59e-36
Family Pilus chaperone 0.0003
Further Details:      
 
Domain Number 2 Region: 126-220
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00000000000000628
Family Periplasmic chaperone C-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2NE25
Sequence length 238
Comment (tr|A0A0A2NE25|A0A0A2NE25_ALCFA) Phytochrome sensor protein {ECO:0000313|EMBL:KGP01119.1} KW=Complete proteome OX=511 OS=Alcaligenes faecalis. GN=JT27_14445 OC=Alcaligenaceae; Alcaligenes.
Sequence
MALSAALLSNQAQASISLSGTRLILPEKQQEASIVVRNDNSPILVQSWLETNTDHDQAEL
PFAITPALVKVAPNGQQVMRVLYAGGDQGLPRDRETVLWLNIQEIPQQSPGDNQLQIAIR
QRIKLFFRPDGLPGSATQAPVDLQWSVVNAQGAPMLEIHNPSAYHVSMSTLRNAKGQEME
DPGMIAPGQTRRLPLGRSAAQDTLQFRAISDYGSADPYEVRLNGQSKVQARALSSDTP
Download sequence
Identical sequences A0A0A2NE25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]