SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2STL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2STL6
Domain Number 1 Region: 125-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.54e-22
Family Ankyrin repeat 0.00079
Further Details:      
 
Domain Number 2 Region: 368-574
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.31e-18
Family Pseudo ankyrin repeat 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2STL6
Sequence length 991
Comment (tr|A0A0A2STL6|A0A0A2STL6_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KGP64107.1} KW=Complete proteome; Reference proteome OX=1498499 OS=Legionella norrlandica. GN=EP47_08160 OC=Legionellaceae; Legionella.
Sequence
MQLEKKEHSAHPIFHKIPWKVWHHAFYTIESSIRYYHVFLRYKDPTRPLQRYEDPLQALL
SIIYFHPELNDATLLELARKLGIKPETIYQAAIITGKRSFFDNVVDTRKPDILQRIRSGY
FFDFLNAAKFGHLEIINGLVNLVPDRVHEIVAAYNFAPLREAATYGYMDIVNRLVELVPD
QVAEMAVAGEYAAFRFAASHGHLDVLDRLIELAPHKVPEMIASFNFSAFCCAAKGGYLNV
LNRLIELAPDKIREMITAENFHAFRYAAANGHLHIINRLIELAPDLVPDMLASDYFFAFH
YAAMGGYLDVMNRLLELAPEKTDDMISALSYSAFRWAARYGHLDLVNRLVALAPNKVDKM
VAADDFFAFKHAAQQGHLHIINRLIELAPDQVINMIIADRFHACHDAIAWGHIPVLIRLM
ELAPNEIAGWIDNNRDLVLTRASNHESMLYHMLNIPENFAYAELHEQCFWYDKIMPFINT
YLEKWHNEQRELEQQSPNQLFNLDNPQEASLGFYMVRHLIRCNDISLSDEIHFLLDIPAI
RHLAHQEMTPNRPNELLRLSLSVGNEDAANILLTIPAVYELAQTQQFYSEEQQAGMDLRA
LATDRESSMNTLTQGEQKRLAEVIKRYRPVLKKQGVAKLAGELRQQLIEIYEKAPATIQI
NNQTISLPLTWIDFNAMSLTPEERQQALQAYYQHKTHTAFRYLSKPNFWMAKNANHVQVN
LDNTNERWSTFEEYLPLIAMFWLAATDKDTPPCDDHTFESRLAHFIEELAFIGRAHNWDK
HRIKTDTHEQALCHIDRPQKGNLITEEYDDLEGDKPSCFSGVKRRLFQSVLGHPLLKVLT
LDGVQEELRNFLRDEFRQRIPNESERALLKQYLDGYIVNLELSDTEKQAFQIFNIRPEQA
NQFIENLANKYGSQLTKAFRTHLEKQLALNPAGGSLLDELHFFRFGEWVNDILLPQSQAK
MSPLAQVGFFSGTEPSGRQLIHSDSMSPPCA
Download sequence
Identical sequences A0A0A2STL6
WP_052117525.1.74665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]