SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2TW95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2TW95
Domain Number 1 Region: 159-312
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.16e-28
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 33-115
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000164
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A2TW95
Sequence length 324
Comment (tr|A0A0A2TW95|A0A0A2TW95_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KGP79934.1} KW=Complete proteome; Reference proteome OX=1395587 OS=Paenibacillus sp. MAEPY2. GN=P364_0121055 OC=Paenibacillus.
Sequence
MANELLEQLNKWHEQDEFGLIIERIQDIPEVDRDYELIGQLARAYNNEGRYREAAQQLLA
VNEQGTSDPLWQYRLGYAYYHIAKYEQALHAFEMANELLPHDESTNEFLEWTRPKAEKMQ
QDRLRHQEILLELEQSGRLNHLRAASGSYDPASFWEQSEYALESYVSPPFDEELIQTIEQ
ELGYQLPASYIHLMNKQNGGIPAHTVFPTNEATSWAEDHIAVTGIMGIGRDKSNTLAGEF
GSRFMIEDWGYPDLGIVICDCPSAGHDVVMLDYRFCGPEGEPAVVHVDQEDDYEITYLAP
NFETFIRGLVDADTFDLSGEEDED
Download sequence
Identical sequences A0A0A2TW95 A0A264DCF0
WP_024632190.1.47880 WP_024632190.1.63575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]