SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2UU53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2UU53
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000126
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A2UU53
Sequence length 154
Comment (tr|A0A0A2UU53|A0A0A2UU53_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KGP85055.1} KW=Complete proteome; Reference proteome OX=1395587 OS=Paenibacillus sp. MAEPY2. GN=P364_0102485 OC=Paenibacillus.
Sequence
MNNLNIDNIQKHYGIVFPHEYLEFQREANGQAFDMIENGEVIDWEIRFSALDNQFIANNI
NLVDDVNPDPRRIIPFAWSVSSGNNYLLDYRKNSESPAVLVMDHEEAMVREDAESESETP
EEAQQLLEENVREIAANFNAFIACLKARPSDPVE
Download sequence
Identical sequences A0A0A2UU53
WP_024628600.1.47880 WP_024628600.1.63575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]