SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2Z6A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2Z6A3
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Ribosomal protein L13 1.7e-61
Family Ribosomal protein L13 0.000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2Z6A3
Sequence length 142
Comment (tr|A0A0A2Z6A3|A0A0A2Z6A3_9PAST) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome OX=750 OS=Gallibacterium anatis. GN=CF557_01195 OC=Pasteurellaceae; Gallibacterium.
Sequence
MKTFVAKPETVKRDWYVVDATGKTLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVINAE
KVAVTGRKKTDKLYYWHTGYVGGIKQATFAEMIARRPERVIEIAVKGMLPKGPLGRDMYR
KLKVYAGSEHNHAAQQPQVLDI
Download sequence
Identical sequences A0A0A2XIP5 A0A0A2Y4Z1 A0A0A2YX44 A0A0A2Z6A3 A0A0A2ZMG1 A0A0A3A1S6
WP_026211022.1.102049 WP_026211022.1.19958 WP_026211022.1.24514 WP_026211022.1.25043 WP_026211022.1.26418 WP_026211022.1.26593 WP_026211022.1.29791 WP_026211022.1.34149 WP_026211022.1.35356 WP_026211022.1.37689 WP_026211022.1.38457 WP_026211022.1.45092 WP_026211022.1.5524 WP_026211022.1.56014 WP_026211022.1.56086 WP_026211022.1.60811 WP_026211022.1.63960 WP_026211022.1.66043 WP_026211022.1.68378 WP_026211022.1.68549 WP_026211022.1.76763 WP_026211022.1.82856 WP_026211022.1.84949 WP_026211022.1.94406 WP_026211022.1.95155 WP_026211022.1.95450 WP_026211022.1.97874 WP_026211022.1.98863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]