SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3ISJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A3ISJ6
Domain Number 1 Region: 15-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000068
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A3ISJ6
Sequence length 250
Comment (tr|A0A0A3ISJ6|A0A0A3ISJ6_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KGR87701.1} KW=Complete proteome OX=1294264 OS=Lysinibacillus boronitolerans JCM 21713 = 10a = NBRC 103108. GN=CD31_06090 OC=Lysinibacillus.
Sequence
MKDLEKKLDAVLQQMRDFIDELQERESAYPMVFYHHPEEDISQFVDGRWSLPAEYVYFLR
HYVVERVTWATGDYINLNIYGARDLIRGQEGYNYNPVTDEMIEDWPHDYLVIATDEGDPY
CLDLSRGDTAVFTAPHGTGNWHFSMAYDNLILFLESVLIPPSLEEMLPEESSVAYYELTI
TGDGKDKLKTLLLLKKLLSYDYSQARKALEQPPLVIYRGVEAGALKLEAELQAIRADFQK
RKISLAEFIE
Download sequence
Identical sequences A0A0A3ISJ6
WP_036076275.1.70198 WP_036076275.1.74654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]