SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A3IT95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A3IT95
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Ribosomal protein L13 2.09e-60
Family Ribosomal protein L13 0.00000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A3IT95
Sequence length 145
Comment (tr|A0A0A3IT95|A0A0A3IT95_9BACI) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome; Reference proteome OX=1220589 OS=Lysinibacillus odysseyi 34hs-1 = NBRC 100172. GN=CD32_04895 OC=Lysinibacillus.
Sequence
MRTTFMAKGHEVERKWLVVDAEGQTLGRLASEVAAILRGKHKPTFTPNVDTGDHVIIINA
DKIHLTGNKLEGKIYYRHTQFAGGLKQRTAGEMKEKYPTQMIELAVKGMLPKNSLGRKMF
GKLNVYAGAEHPHAAQKPEAYELRG
Download sequence
Identical sequences A0A0A3IT95
WP_036151899.1.19363 WP_036151899.1.29005 WP_036151899.1.47185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]