SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A4AN85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A4AN85
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily TrpR-like 1.62e-29
Family Trp repressor, TrpR 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A4AN85
Sequence length 110
Comment (tr|A0A0A4AN85|A0A0A4AN85_DICCH) Trp operon repressor {ECO:0000256|HAMAP-Rule:MF_00475, ECO:0000256|SAAS:SAAS00907407} KW=Complete proteome OX=556 OS=chrysanthemi). GN=NM75_05830 OC=Pectobacteriaceae; Dickeya.
Sequence
MTSPSLHDPVFSEQDDENWQAFVSLFQQAMAEGLEQPLLQLLLTPDERTALGTRVRIIQE
LMRGEMSQRELKNELGAGIATITRGSNSLKSAPARLKVWLEEQLLPEKKD
Download sequence
Identical sequences A0A089WTH4 A0A0A4AN85
WP_038665501.1.17782 WP_038665501.1.1785 WP_038665501.1.71232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]