SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A4HNW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A4HNW6
Domain Number 1 Region: 10-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000863
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A4HNW6
Sequence length 157
Comment (tr|A0A0A4HNW6|A0A0A4HNW6_9PSED) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KGU84159.1} KW=Complete proteome OX=1348058 OS=Pseudomonas mediterranea CFBP 5447. GN=N005_12305 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MLENKFSDCETAITSTDLDHLETIIGKKLPVTFRNHYLKYNGGMPERAYWVSEDFYDPIE
VASFRPIAYGEPTLLSTYQLMLKKQVLPTHLLPFADDLGGNFFCLNLDSGAISYFTTDTF
DSDLSPEENQAESEKLVCSNFLRFVQGLIDEEDLDEA
Download sequence
Identical sequences A0A0A4HNW6
WP_047701458.1.23779 WP_047701458.1.42967 WP_047701458.1.44014 WP_047701458.1.68927 WP_047701458.1.76864 WP_047701458.1.95574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]