SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A5FWN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A5FWN4
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.02e-30
Family AadK C-terminal domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A5FWN4
Sequence length 98
Comment (tr|A0A0A5FWN4|A0A0A5FWN4_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KGX84334.1} KW=Complete proteome; Reference proteome OX=1385512 OS=Pontibacillus litoralis JSM 072002. GN=N784_13710 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MDWWIGIEYDFQVSTGKMGKYFKKFLPESYWEMYQATYSDGSYENIWDSVFITCELFRAL
ARDVAKSLSYTYPADDDKNMMEYLHYVRKLPADAKGIY
Download sequence
Identical sequences A0A0A5FWN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]