SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A5G362 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A5G362
Domain Number 1 Region: 58-190
Classification Level Classification E-value
Superfamily Sortase 8.63e-33
Family Sortase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A5G362
Sequence length 193
Comment (tr|A0A0A5G362|A0A0A5G362_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KGX85568.1} KW=Complete proteome; Reference proteome OX=1385512 OS=Pontibacillus litoralis JSM 072002. GN=N784_08650 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MKKLSYLFIIVGVAFVSYALIELYNTHAQTNQSLEEAQQYIDAGSNPATQLDDDRFIPDQ
GASVGLLSIPKLNAELPIIEGTDPNDLAKGVGHYKGSYYPEENGQIVLSGHRDTVFRQIG
ELDLGDTFEVELPYGTYTYEMVETEIVPADDESVITLQDQEEELIVTTCYPFSYIGDAPD
RYIMYAKRIDESK
Download sequence
Identical sequences A0A0A5G362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]