SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A5GJ52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A5GJ52
Domain Number 1 Region: 28-166
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000183
Family SMI1/KNR4-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A5GJ52
Sequence length 193
Comment (tr|A0A0A5GJ52|A0A0A5GJ52_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KGX91258.1} KW=Complete proteome; Reference proteome OX=1385511 OS=Pontibacillus marinus BH030004 = DSM 16465. GN=N783_10965 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Pontibacillus.
Sequence
MSETPIINELSNLGVSISEKPFDKDQQMEHLRKIENLFSISIPDDYKEFLLLYNQVLFEN
YITISPKVLPELGGHILEELYGLDCLSYHMNRYSDRIPSSFIPIGECVGGDLVLIGIKED
SDGKVFIWDHENELQARLMLGEKVEADLNSYKENLHLISQTFVEFLSILEIDDNDDLELD
GVEIWLDDDLLDD
Download sequence
Identical sequences A0A0A5GJ52
WP_027445413.1.47255 WP_027445413.1.87926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]