SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A5IEP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A5IEP2
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Serpins 4.58e-30
Family Serpins 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A5IEP2
Sequence length 198
Comment (tr|A0A0A5IEP2|A0A0A5IEP2_PARBP) Uncharacterized protein {ECO:0000313|EMBL:KGY14930.1} KW=Complete proteome OX=482561 OS=Paracoccidioides brasiliensis (strain Pb03). GN=PABG_12207 OC=Paracoccidioides.
Sequence
MPCHMMHRTSEILYWEDNIAQMSDASPTWNATIILPKTPGAGSVLAILAPFSASPSTLRS
LLVTSHSDTASGQPWSLKPTFLHLSLPRFTLKQSTDISEPLFNLGLRPICRPSADFAPIS
RSQPAYVTNIKHDLFVEVNEEGTEVAAVTSLGVFGGAASAMRVPVAMRVDRPFLFVVFDA
GTGVVLCSSVVSEVGKGE
Download sequence
Identical sequences A0A0A5IEP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]