SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A6PWQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A6PWQ7
Domain Number - Region: 10-115
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.00981
Family Cell wall binding repeat 0.026
Further Details:      
 
Domain Number - Region: 98-135
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 0.0595
Family GW domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A6PWQ7
Sequence length 145
Comment (tr|A0A0A6PWQ7|A0A0A6PWQ7_CLOBU) Uncharacterized protein {ECO:0000313|EMBL:KHD15445.1} KW=Complete proteome OX=1492 OS=Clostridium butyricum. GN=OA81_09410 OC=Clostridium.
Sequence
MVFIFLLLIILLLGGGGFFFLKSYDDKYVALQKNNMLLKSQLSKIKEKYDLLDSSTQNCN
LEFLTVDNHYGLLPKNTIVRISPSNNSCIVKKIDMGMQVGILEKVNTNDSTWYYVALPLD
NNINSRGWVEEPAFSEISNSPIEIS
Download sequence
Identical sequences A0A0A6PWQ7 N9YTD7 W1WEM4
WP_002582555.1.34338 WP_002582555.1.57752 WP_002582555.1.64220 WP_002582555.1.80406 WP_002582555.1.80740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]