SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7EUB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7EUB7
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Annexin 0.00000000000000628
Family Annexin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7EUB7
Sequence length 53
Comment (tr|A0A0A7EUB7|A0A0A7EUB7_9CICH) Annexin A4 {ECO:0000313|EMBL:AIY70653.1} OX=64551 OS=Tilapia sparrmanii (banded tilapia). GN=anxa4 OC=Pseudocrenilabrinae; Tilapiini; Tilapia.
Sequence
AKEIYEAGEARWGTDEVKFLTVLCVRNRNHLLRVFQEYQKISGRDIEESIKRE
Download sequence
Identical sequences A0A0A7EU87 A0A0A7EU92 A0A0A7EU99 A0A0A7EUB3 A0A0A7EUB7 A0A0A7EUE7 A0A0A7EUF2 A0A0A7EUT0 A0A0A7EUT5 A0A0A7EUU8 A0A0A7EUV2 A0A0A7EW02 A0A0A7EW13 A0A0A7EW17 A0A0A7EW23 A0A0A7EW28 A0A0A7EW64 A0A0A7EW84 A0A0A7EW89 A0A0A7EW94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]