SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7JRD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7JRD1
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.89e-45
Family SMI1/KNR4-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7JRD1
Sequence length 135
Comment (tr|A0A0A7JRD1|A0A0A7JRD1_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:AIZ34997.1} KW=Complete proteome OX=157782 OS=Pseudomonas parafulva. GN=NJ69_19305 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLREANEPVPVPLELPDEDQLVEIEEELFINIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVPRDLIPLCQDGDNYYCVEEDGTVVLWDGDEEIVGEDS
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0A7JRD1
WP_039582386.1.66304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]