SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7M3B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7M3B8
Domain Number 1 Region: 1-147,176-196
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.24e-55
Family Duffy binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A7M3B8
Sequence length 196
Comment (tr|A0A0A7M3B8|A0A0A7M3B8_PLAFA) Var-MDBLa_117 protein {ECO:0000313|EMBL:AIZ73446.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-MDBLa_117 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ACAPYRRLSLCDTNLEQIKTENITTHNLLVDVLLAAKYEGDSIRGYYAQYDEQYPSSGST
MCTMLARSFADIGDIIRGKDLYRGNNGKDKLEKNLKKIFEKIHEGLDRKIKSNYNDAPYY
YKLREDWWYANRAKVWYAMTCGAGTSAQYFRQTCGGSGNNATLAKNKCRCDGKNADQVPT
YFDYVPQYLRWFEEWA
Download sequence
Identical sequences A0A0A7M3B8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]