SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7M552 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7M552
Domain Number 1 Region: 5-147
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-39
Family Duffy binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7M552
Sequence length 147
Comment (tr|A0A0A7M552|A0A0A7M552_PLAFA) Var-544 protein {ECO:0000313|EMBL:AIZ73293.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var-544 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LHQQKYGDSPSEMCTMFARSFADIGDIVRGRDLYRGNKKENKQRKQLDDSLKKIFGKIHS
GLSKGAQTYYNDDKENYYQLREDWWDVNRKKVWDAITCGAPDEGEYFRKTACAGTRTNDK
CRCKGDQVPTYFDYVPQYLRWFEEWAE
Download sequence
Identical sequences A0A0A7M552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]