SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7PLW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7PLW7
Domain Number 1 Region: 16-79
Classification Level Classification E-value
Superfamily TrpR-like 0.0000000000000481
Family SPO1678-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7PLW7
Sequence length 124
Comment (tr|A0A0A7PLW7|A0A0A7PLW7_9SPHN) ISCc3, transposase OrfA {ECO:0000313|EMBL:AJA08932.1} KW=Complete proteome OX=1515612 OS=Sphingopyxis fribergensis. GN=SKP52_10125 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MKPKSSRSKLPAEQVVKDIRRKTRRHFSAEDKIRIVLDGLRGDDSIAELCRREGIAQSLY
YTWSKEFMEAGKRRLAGDTARAATTDEVKGLRREARDLKECVADLTLENRLLKKSMIADG
GDEE
Download sequence
Identical sequences A0A0A7PLW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]