SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7RC74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7RC74
Domain Number 1 Region: 7-36,73-144
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000017
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7RC74
Sequence length 174
Comment (tr|A0A0A7RC74|A0A0A7RC74_ANAPH) AnkA {ECO:0000313|EMBL:AJA32740.1} OX=948 OS=Anaplasma phagocytophilum (Ehrlichia phagocytophila). GN=ankA OC=Anaplasmataceae; Anaplasma; phagocytophilum group.
Sequence
VDAQSHDGKTIIHCAAKDGNLEILQQALGRKSSYSKFPVRDGVPTPGVYAVREAKDPKGL
EKVLDALMDREPNPQHVAVEAIKRGSRELLDHLITKKVVDVNERFVNSEGQETTLAFEAL
GAGQYDIVKYLIKNGAAVEGVANESALAAGILGGCFQGRRAVLHMERVIGAGAS
Download sequence
Identical sequences A0A0A7RC74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]