SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7S684 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7S684
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily BH3703-like 0.000000000000392
Family BH3703-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7S684
Sequence length 124
Comment (tr|A0A0A7S684|A0A0A7S684_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:AJA44791.1} KW=Complete proteome; Reference proteome OX=1267021 OS=Frischella perrara. GN=FPB0191_00965 OC=Frischella.
Sequence
MSKTYNQLNNEIGQLLFKSSPNGAKKVIAQLEFTPEMDVCRYLFDYYNQNDELNWYLLDD
DITDPLIDTVTELRQYYIDNNLTNGLPAWRGCIITVDIENAKIDFEFKYEPFIDLYSEYD
DHDE
Download sequence
Identical sequences A0A0A7S684
WP_052236764.1.21977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]