SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7S9P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7S9P4
Domain Number 1 Region: 54-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000876
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7S9P4
Sequence length 180
Comment (tr|A0A0A7S9P4|A0A0A7S9P4_9GAMM) Protein Syd {ECO:0000256|HAMAP-Rule:MF_01104, ECO:0000256|SAAS:SAAS00851392} KW=Complete proteome; Reference proteome OX=1267021 OS=Frischella perrara. GN=FPB0191_02242 OC=Frischella.
Sequence
MTKPSLALKDFTQRYVDEWQATCHHDPKSYELYDIASPCITSTHDSAVFWRPVPAQDHSL
TIVEQVIFITLHPDAHDFYQTQYAGDMAATFNGLTLTLIQIWNDDDFSRLEQNLIAHLNM
QKKLKRRPSVFIASTSDNTEIITIDNQTGNIMLERLVDNENQILADNLAEFLAQLKPIAQ
Download sequence
Identical sequences A0A0A7S9P4
WP_039106171.1.21977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]