SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8B3Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8B3Q3
Domain Number 1 Region: 43-230
Classification Level Classification E-value
Superfamily Sortase 3.92e-29
Family Sortase 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A8B3Q3
Sequence length 235
Comment (tr|A0A0A8B3Q3|A0A0A8B3Q3_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AJC12015.1} KW=Complete proteome; Reference proteome OX=1531429 OS=Coriobacteriaceae bacterium 68-1-3. GN=JI75_04370 OC=Coriobacteriaceae.
Sequence
MKNGTRKVLVALSCLAIVAGVAMFVLGQGGVEQNPSPTYQRAITDPDEEGQDRVIDWGSL
PDSVIAWVYVPGTTIDYPVVRGFTEDPGFYLFHDAEGRYSAWGTPYVANGCEEGLESPLV
MIYGHHMSDGTMFAPLAGYSSRPFAEEHAEIILYTPEQTLHLEPVLVNVINANKKNVRLS
FGDQGELEEYMAAEEAESEVVLDGYRSGRQVFAFVTCSYETSNSRTVVYAMEAES
Download sequence
Identical sequences A0A0A8B3Q3
WP_039689014.1.53338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]