SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8E7N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8E7N0
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 8.42e-27
Family Ribosomal proteins L24p and L21e 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A8E7N0
Sequence length 107
Comment (tr|A0A0A8E7N0|A0A0A8E7N0_MYCFL) 50S ribosomal protein L24 {ECO:0000256|HAMAP-Rule:MF_01326} KW=Complete proteome OX=743971 OS=Mycoplasma flocculare ATCC 27399. GN=MYF_02450 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MAKIRKNDTVLVLSGDDKGKVSSVLEIIPSKKSAIVKGINTKTKHKKPSNKNTTGEIVNF
DAPILFSKLALVAKKATKDKPAIPTRVGFKFENGNKIRIAKKTGKAI
Download sequence
Identical sequences A0A0A8E7N0
WP_002557828.1.53963 WP_002557828.1.57545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]