SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8EV61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8EV61
Domain Number 1 Region: 141-287
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.84e-16
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8EV61
Sequence length 315
Comment (tr|A0A0A8EV61|A0A0A8EV61_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AJC57911.1} KW=Complete proteome; Reference proteome OX=1262452 OS=Streptomyces sp. 769. GN=GZL_05336 OC=Streptomyces.
Sequence
MPPNSAYAGQVVHFPDPVRAARYPAGVRMDADGFPDFSSYARAAAEIAEPPEGFGVDELR
LTDFVSANAALHAQGHELWIDVPSVATPHGWTWHHVAGTRRMELIPVEVKALLRHHAGLA
TAAVAHDKRGTRPLQETRPVHLGLPRRELAVSEEQVAQAEEALGYRLPGAYRSFLKAAGG
CAPVGAALDAELGLLVDQPFFTVRDDAAVNDLVYVNKCLRDHFTKDYLGVVFVQGGVIAV
KVRGEALGSVWFCPYDDARDQDGWSVRERVERLMLPCGADFDDFLLRLAGNPPELETVAN
LMVDGGFAYAVPVEG
Download sequence
Identical sequences A0A0A8EV61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]