SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8JB12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8JB12
Domain Number 1 Region: 36-246
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.54e-110
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000301
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0000000000011
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A8JB12
Sequence length 246
Comment (tr|A0A0A8JB12|A0A0A8JB12_9EURY) Methyl-coenzyme M reductase {ECO:0000313|EMBL:BAQ02526.1} OX=109046 OS=Methanosarcina baltica. GN=mcrA OC=Methanosarcinaceae; Methanosarcina.
Sequence
FISAYNMCAGEAAVADLSFSAKHASLVSMGEMLPARRARSPNEPGGLSFGHLSDIIQTSR
VDAEDPAHVSLEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNTYYDVDYI
NDKYDGAANVGTDNKVKASLEVIKDIATESTLYGIETYENFPTALEDHFGGSQRATVLAA
ASGVAASIATGNANAGLSGWYLSMYLHKEAWGRLGFFGFDLQDQCGATNICTYQGDEGLP
DELRGP
Download sequence
Identical sequences A0A0A8JB12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]