SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8KZ37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8KZ37
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily Prefoldin 9.42e-17
Family Prefoldin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8KZ37
Sequence length 113
Comment (tr|A0A0A8KZ37|A0A0A8KZ37_9SACH) WGS project CCBQ000000000 data, contig 00107 {ECO:0000313|EMBL:CDO91813.1} KW=Complete proteome OX=1427455 OS=Kluyveromyces dobzhanskii CBS 2104. GN=KLDO_g146 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MSAPPQDIVKEMSNSLRNTRSQLDMTVVQLTQLQRQKKIAELTDDELGNYQNEKVWRSCG
RMFINQDKQAYTVDLHRDEKELEEQIKALEQKRHYLEITMENTVESLRRVLGN
Download sequence
Identical sequences A0A0A8KZ37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]