SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8RC41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8RC41
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000222
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8RC41
Sequence length 124
Comment (tr|A0A0A8RC41|A0A0A8RC41_PSEAI) Uncharacterized protein {ECO:0000313|EMBL:CEI00432.1} KW=Complete proteome OX=287 OS=Pseudomonas aeruginosa. GN=PAMH19_0623 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MHCSPWTSPMKPELDALEAWLGQPLPAAFVAALEQHGGRLVEPDLLLYAADELLERNRAF
ETSLYCPGYLAIGDDSGGRAVVMALDDHWQALFLVDHGAMTPDCFEPLTPSLEAWLEAGP
CLPE
Download sequence
Identical sequences A0A0A8RC41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]