SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8RJN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8RJN9
Domain Number 1 Region: 31-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.23e-42
Family SMI1/KNR4-like 0.000000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A8RJN9
Sequence length 162
Comment (tr|A0A0A8RJN9|A0A0A8RJN9_PSEAI) Uncharacterized protein {ECO:0000313|EMBL:CEI14302.1} KW=Complete proteome OX=287 OS=Pseudomonas aeruginosa. GN=PAMH19_3103 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAEGQPRHLSCARCGYCIKSAPPVAREPVVEDVIEKLRELNEPVPVPLELPEEELLVEIE
EELLIGIPAEFREFLLLVSDVVYGRLEPVTVTDPHSHTYLPEVAATAWDLGVPRELIPLC
EDDGSYYCVAEDGEVVLWADGDLTDESWDSVWVWARDVWLES
Download sequence
Identical sequences A0A0A8RJN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]