SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A8TPL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8TPL3
Domain Number 1 Region: 11-98
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000034
Family PG0164-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8TPL3
Sequence length 101
Comment (tr|A0A0A8TPL3|A0A0A8TPL3_ACIBZ) Uncharacterized protein {ECO:0000313|EMBL:CEI54276.1} KW=Complete proteome OX=106648 OS=Acinetobacter bereziniae (Acinetobacter genomosp. 10). GN= OC=Moraxellaceae; Acinetobacter.
Sequence
MIDNERQFSVESTVQRYSGAGGWHYVIVPKKQAMEIKNYLLQRQSWGLISVTVTVGQSVW
KTSIFPDKQSEGYLLPLKAEIRNKEKIYLGDSILFSIALSV
Download sequence
Identical sequences A0A0A8TPL3 N9DBK0
WP_005032289.1.27157 WP_005032289.1.6941 WP_005032289.1.76589 WP_005032289.1.90496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]